PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g096430.1
Common NameMTR_1g096430
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family NAC
Protein Properties Length: 340aa    MW: 39409.8 Da    PI: 7.0336
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g096430.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.18.6e-5471351128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                      +ppGfrFhPt+eelv +yL++k+++ k++l +vi evd+yk+ePwd++      +++++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk+
  Medtr1g096430.1   7 VPPGFRFHPTEEELVGYYLNRKINSLKIDL-DVIVEVDLYKIEPWDIQDrckLGYEQQNEWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKA 99 
                      69****************************.99**************952432234677*********************************** PP

              NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      v+s k++ +g++ktLvfykgrap+g+ktdW+mheyr 
  Medtr1g096430.1 100 VTS-KNRIIGMRKTLVFYKGRAPNGRKTDWIMHEYRH 135
                      ***.8999***************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-595156IPR003441NAC domain
PROSITE profilePS5100556.9747156IPR003441NAC domain
PfamPF023654.9E-288134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009735Biological Processresponse to cytokinin
GO:0009737Biological Processresponse to abscisic acid
GO:0009741Biological Processresponse to brassinosteroid
GO:0045491Biological Processxylan metabolic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:0050832Biological Processdefense response to fungus
GO:0071365Biological Processcellular response to auxin stimulus
GO:0090059Biological Processprotoxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MDMESCVPPG FRFHPTEEEL VGYYLNRKIN SLKIDLDVIV EVDLYKIEPW DIQDRCKLGY  60
EQQNEWYFFS HKDKKYPTGT RTNRATAAGF WKATGRDKAV TSKNRIIGMR KTLVFYKGRA  120
PNGRKTDWIM HEYRHQTSEH GPPQAKGWVV CRAFKKPSPS HRPGYEPWYS NQQQPQYFRD  180
DQNYATTRPL SITDILHENR LLLQNPAAEG TSFSHPFSND QQFLSNQNTL VMDNKQLIEL  240
PQLDSPTTSF AIKENTHHNG LTIEEYCSEE RSNNINNNNG QVIDWKSLDN LFTSTNQFTD  300
TANYFSNQNS MPLMIPHSQH ELQSHQNQAN HILGCFPDS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-49716217171NO APICAL MERISTEM PROTEIN
1ut4_B1e-49716217171NO APICAL MERISTEM PROTEIN
1ut7_A1e-49716217171NO APICAL MERISTEM PROTEIN
1ut7_B1e-49716217171NO APICAL MERISTEM PROTEIN
3swm_A1e-49716220174NAC domain-containing protein 19
3swm_B1e-49716220174NAC domain-containing protein 19
3swm_C1e-49716220174NAC domain-containing protein 19
3swm_D1e-49716220174NAC domain-containing protein 19
3swp_A1e-49716220174NAC domain-containing protein 19
3swp_B1e-49716220174NAC domain-containing protein 19
3swp_C1e-49716220174NAC domain-containing protein 19
3swp_D1e-49716220174NAC domain-containing protein 19
4dul_A1e-49716217171NAC domain-containing protein 19
4dul_B1e-49716217171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00017PBMTransfer from AT1G71930Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150411e-98AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013469520.10.0NAC transcription factor-like protein
SwissprotQ9C8W91e-115NAC30_ARATH; NAC domain-containing protein 30
TrEMBLA0A072VQ650.0A0A072VQ65_MEDTR; NAC transcription factor-like protein
STRINGGLYMA10G36050.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF71383247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71930.11e-105vascular related NAC-domain protein 7
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]